PDB entry 1se2

View 1se2 on RCSB PDB site
Description: staphylococcal enterotoxin c2, monoclinic form
Class: toxin
Keywords: enterotoxin, superantigen
Deposited on 1995-07-20, released 1996-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.196
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal enterotoxin c2
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1se2a1, d1se2a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1se2A (A:)
    esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
    nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1se2A (A:)
    esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdntggktcmyggitkhegnhfd
    ngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetg
    yikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng