PDB entry 1sdv

View 1sdv on RCSB PDB site
Description: Crystal structures of HIV protease V82A and L90M mutants reveal changes in indinavir binding site.
Class: hydrolase
Keywords: Drug resistance; HIV-1 Protease, HYDROLASE
Deposited on 2004-02-14, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.16
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367
      • variant (6)
      • variant (32)
      • variant (62)
      • variant (66)
      • variant (81)
      • variant (94)
    Domains in SCOPe 2.07: d1sdva_
  • Chain 'B':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • variant (6)
      • variant (32)
      • variant (62)
      • variant (66)
      • variant (81)
      • variant (94)
    Domains in SCOPe 2.07: d1sdvb_
  • Heterogens: CL, MK1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdvA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sdvB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf