PDB entry 1sdu

View 1sdu on RCSB PDB site
Description: Crystal structures of HIV protease V82A and L90M mutants reveal changes in indinavir binding site.
Class: hydrolase
Keywords: Drug resistance HIV-1 Protease, HYDROLASE
Deposited on 2004-02-14, released 2004-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.142
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367
    • variant (6)
    • variant (32)
    • variant (62)
    • variant (66)
    • variant (89)
    • variant (94)
  Domains in SCOPe 2.06: d1sdua_
• Chain 'B':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • variant (6)
    • variant (32)
    • variant (62)
    • variant (66)
    • variant (89)
    • variant (94)
  Domains in SCOPe 2.06: d1sdub_
• Heterogens: SO4, ACT, MK1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sduA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlmtqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sduB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlmtqigatlnf