PDB entry 1sde

View 1sde on RCSB PDB site
Description: Toward Better Antibiotics: Crystal Structure Of D-Ala-D-Ala Peptidase inhibited by a novel bicyclic phosphate inhibitor
Class: hydrolase
Keywords: cyclic phosphate, peptidoglycan, penicillin binding protein, antibiotic, hydrolase
Deposited on 2004-02-13, released 2004-10-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.119
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Streptomyces sp. [TaxId:31952]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1sdea_
  • Heterogens: 2PB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sdeA (A:)
    adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
    gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
    aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
    teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
    isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
    tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sdeA (A:)
    lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs
    vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq
    tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate
    yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis
    stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv
    qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp