PDB entry 1sch

View 1sch on RCSB PDB site
Description: peanut peroxidase
Class: oxidoreductase
Keywords: calcium binding, glycosylation, peroxidase, oxidoreductase
Deposited on 1996-01-23, released 1996-07-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.199
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peanut peroxidase, major cationic isozyme
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1scha_
  • Chain 'B':
    Compound: peanut peroxidase, major cationic isozyme
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1schb_
  • Heterogens: NAG, CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1schA (A:)
    elssnfyatkcpnalstiksavnsavakearmgasllrlhfhdcfvqgcdasvllddtsn
    ftgektagpnansirgfevidtiksqveslcpgvvscadilavaardsvvalggaswnvl
    lgrrdsttaslssansdlpapffnlsglisafsnkgfttkelvtlsgahtigqaqctafr
    triynesnidptyakslqancpsvggdtnlspfdvttpnkfdnayyinlrnkkgllhsdq
    qlfngvstdsqvtaysnnaatfntdfgnamikmgnlspltgtsgqirtncrktn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1schB (B:)
    elssnfyatkcpnalstiksavnsavakearmgasllrlhfhdcfvqgcdasvllddtsn
    ftgektagpnansirgfevidtiksqveslcpgvvscadilavaardsvvalggaswnvl
    lgrrdsttaslssansdlpapffnlsglisafsnkgfttkelvtlsgahtigqaqctafr
    triynesnidptyakslqancpsvggdtnlspfdvttpnkfdnayyinlrnkkgllhsdq
    qlfngvstdsqvtaysnnaatfntdfgnamikmgnlspltgtsgqirtncrktn