PDB entry 1sch

View 1sch on RCSB PDB site
Description: peanut peroxidase
Deposited on 1996-01-23, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.199
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1scha_
  • Chain 'B':
    Domains in SCOP 1.55: d1schb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1schA (A:)
    elssnfyatkcpnalstiksavnsavakearmgasllrlhfhdcfvqgcdasvllddtsn
    ftgektagpnansirgfevidtiksqveslcpgvvscadilavaardsvvalggaswnvl
    lgrrdsttaslssansdlpapffnlsglisafsnkgfttkelvtlsgahtigqaqctafr
    triynesnidptyakslqancpsvggdtnlspfdvttpnkfdnayyinlrnkkgllhsdq
    qlfngvstdsqvtaysnnaatfntdfgnamikmgnlspltgtsgqirtncrktn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1schB (B:)
    elssnfyatkcpnalstiksavnsavakearmgasllrlhfhdcfvqgcdasvllddtsn
    ftgektagpnansirgfevidtiksqveslcpgvvscadilavaardsvvalggaswnvl
    lgrrdsttaslssansdlpapffnlsglisafsnkgfttkelvtlsgahtigqaqctafr
    triynesnidptyakslqancpsvggdtnlspfdvttpnkfdnayyinlrnkkgllhsdq
    qlfngvstdsqvtaysnnaatfntdfgnamikmgnlspltgtsgqirtncrktn