PDB entry 1sce

View 1sce on RCSB PDB site
Description: crystal structure of the cell cycle regulatory protein suc1 reveals a novel beta-hinge conformational switch
Class: cell cycle regulatory protein
Keywords: cell cycle regulatory protein
Deposited on 1995-05-11, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: suc1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1scea_
  • Chain 'B':
    Compound: suc1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sceb_
  • Chain 'C':
    Compound: suc1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1scec_
  • Chain 'D':
    Compound: suc1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sced_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sceA (A:)
    msksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpet
    gtlrilqeeewrglgitqslgwemyevhvpephillfkrekdyqmksqqrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sceA (A:)
    vprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetgtlri
    lqeeewrglgitqslgwemyevhvpephillfkrekd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sceB (B:)
    msksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpet
    gtlrilqeeewrglgitqslgwemyevhvpephillfkrekdyqmksqqrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sceB (B:)
    vprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetgtlri
    lqeeewrglgitqslgwemyevhvpephillfkrekd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sceC (C:)
    msksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpet
    gtlrilqeeewrglgitqslgwemyevhvpephillfkrekdyqmksqqrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sceC (C:)
    sksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetg
    tlrilqeeewrglgitqslgwemyevhvpephillfkrekdyqmksqqrgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sceD (D:)
    msksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpet
    gtlrilqeeewrglgitqslgwemyevhvpephillfkrekdyqmksqqrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sceD (D:)
    ksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetgt
    lrilqeeewrglgitqslgwemyevhvpephillfkrekdyqm