PDB entry 1sbs

View 1sbs on RCSB PDB site
Description: crystal structure of an anti-hcg fab
Deposited on 1998-04-08, released 1999-04-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-13, with a file datestamp of 1999-04-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbsH (H:)
    evnleesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvadirlksnnyat
    lyaesvkgrftisrddskssvylqmnnlraedtgiyyctrgayyrydyamdywgqgtsvt
    vssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbsL (L:)
    divmsqspsslavsvgekvtmtckssqsllyssnqmnylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissveaedlavyycqqyhsypftfgsgtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec