PDB entry 1sbg

View 1sbg on RCSB PDB site
Description: an orally-bioavailable hiv-1 protease inhibitor containing an imidazole-derived peptide bond replacement. crystallographic and pharmacokinetic analysis
Class: hydrolase(acid protease)
Keywords: hydrolase(acid protease)
Deposited on 1994-05-24, released 1994-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11678]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-98)
  Domains in SCOPe 2.06: d1sbga_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11678]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-98)
  Domains in SCOPe 2.06: d1sbgb_
• Heterogens: IM1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sbgA (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sbgB (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf