PDB entry 1sbg

View 1sbg on RCSB PDB site
Description: an orally-bioavailable hiv-1 protease inhibitor containing an imidazole-derived peptide bond replacement. crystallographic and pharmacokinetic analysis
Deposited on 1994-05-24, released 1994-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-15.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1sbga_
  • Chain 'B':
    Domains in SCOP 1.57: d1sbgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sbgA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sbgB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf