PDB entry 1sbg

View 1sbg on RCSB PDB site
Description: an orally-bioavailable hiv-1 protease inhibitor containing an imidazole-derived peptide bond replacement. crystallographic and pharmacokinetic analysis
Class: hydrolase(acid protease)
Keywords: hydrolase(acid protease)
Deposited on 1994-05-24, released 1994-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11678]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sbga_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11678]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sbgb_
  • Heterogens: IM1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbgA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sbgB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf