PDB entry 1san

View 1san on RCSB PDB site
Description: the des(1-6)antennapedia homeodomain: comparison of the nmr solution structure and the dna binding affinity with the intact antennapedia homeodomain
Deposited on 1994-01-07, released 1994-04-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1san__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1san_ (-)
    mtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkkenktkge
    pg