PDB entry 1sae

View 1sae on RCSB PDB site
Description: high resolution solution nmr structure of the oligomerization domain of p53 by multi-dimensional nmr (sac structures)
Class: anti-oncogene
Keywords: anti-oncogene
Deposited on 1995-03-12, released 1995-10-15
The last revision prior to the SCOP 1.75 freeze date was dated 2008-09-30, with a file datestamp of 2008-09-26.
Experiment type: NMR77
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOP 1.75: d1saea_
• Chain 'B':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOP 1.75: d1saeb_
• Chain 'C':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOP 1.75: d1saec_
• Chain 'D':
  Compound: tumor suppressor p53
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-41)
  Domains in SCOP 1.75: d1saed_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1saeA (A:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1saeB (B:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1saeC (C:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1saeD (D:)
  kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg