PDB entry 1sae
View 1sae on RCSB PDB site
Description: high resolution solution nmr structure of the oligomerization domain of p53 by multi-dimensional nmr (sac structures)
Class: anti-oncogene
Keywords: anti-oncogene
Deposited on
1995-03-12, released
1995-10-15
The last revision prior to the SCOP 1.75 freeze date was dated
2008-09-30, with a file datestamp of
2008-09-26.
Experiment type: NMR77
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.19
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: tumor suppressor p53
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1saea_ - Chain 'B':
Compound: tumor suppressor p53
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1saeb_ - Chain 'C':
Compound: tumor suppressor p53
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1saec_ - Chain 'D':
Compound: tumor suppressor p53
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1saed_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1saeA (A:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1saeB (B:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1saeC (C:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1saeD (D:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg