PDB entry 1sa3

View 1sa3 on RCSB PDB site
Description:
Deposited on 2004-02-06, released 2004-09-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.223
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1sa3a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1sa3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sa3A (A:)
    mrtellsklyddfgidqlphtqhgvtsdrlgklyekyildifkdieslkkyntnafpqek
    disskllkalnldldniidvsssdtdlgrtiaggspktdatirftfhnqssrlvplnikh
    sskkkvsiaeydvetictgvgisdgelkelirkhqndqsaklftpvqkqrltellepyre
    rfirwcvtlraeksegnilhpdllirfqvidreyvdvtikniddyvsdriaegskarkpg
    fgtglnwtyasgskakkmqfkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sa3B (B:)
    mrtellsklyddfgidqlphtqhgvtsdrlgklyekyildifkdieslkkyntnafpqek
    disskllkalnldldniidvsssdtdlgrtiaggspktdatirftfhnqssrlvplnikh
    sskkkvsiaeydvetictgvgisdgelkelirkhqndqsaklftpvqkqrltellepyre
    rfirwcvtlraeksegnilhpdllirfqvidreyvdvtikniddyvsdriaegskarkpg
    fgtglnwtyasgskakkmqfkg