PDB entry 1s9i

View 1s9i on RCSB PDB site
Description: X-ray structure of the human mitogen-activated protein kinase kinase 2 (MEK2)in a complex with ligand and MgATP
Deposited on 2004-02-04, released 2004-11-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.294
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1s9ia_
  • Chain 'B':
    Domains in SCOP 1.71: d1s9ib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s9iA (A:)
    eafltqkakvgelkdddferiselgagnggvvtkvqhrpsglimarklihleikpairnq
    iirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkeakripeeilgkvs
    iavlrglaylrekhqimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsym
    aperlqgthysvqsdiwsmglslvelavgrypipppdakeleaifgrpvvdgeegephsi
    sprprppgrpvsghgmdsrpamaifelldyivnepppklpngvftpdfqefvnkcliknp
    aeradlkmltnhtfikrseveevdfagwlcktlrlnqpgtptrtavlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9iA (A:)
    qkakvgelkdddferiselgagnggvvtkvqhrpsglimarklihleikpairnqiirel
    qvlhecnspyivgfygafysdgeisicmehmdggsldqvlkeakripeeilgkvsiavlr
    glaylrekhqimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmvgtrsymaperlqgth
    ysvqsdiwsmglslvelavgrypipppdakeleaifgrpvvdrpamaifelldyivnepp
    pklpngvftpdfqefvnkcliknpaeradlkmltnhtfikrseveevdfagwlcktlrln
    qpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s9iB (B:)
    eafltqkakvgelkdddferiselgagnggvvtkvqhrpsglimarklihleikpairnq
    iirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkeakripeeilgkvs
    iavlrglaylrekhqimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsym
    aperlqgthysvqsdiwsmglslvelavgrypipppdakeleaifgrpvvdgeegephsi
    sprprppgrpvsghgmdsrpamaifelldyivnepppklpngvftpdfqefvnkcliknp
    aeradlkmltnhtfikrseveevdfagwlcktlrlnqpgtptrtavlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9iB (B:)
    tqkakvgelkdddferiselgagnggvvtkvqhrpsglimarklihleikpairnqiire
    lqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkeakripeeilgkvsiavl
    rglaylrekhqimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmtrsymaperlqgthy
    svqsdiwsmglslvelavgrypipppdakeleaifgrmaifelldyivnepppklpngvf
    tpdfqefvnkcliknpaeradlkmltnhtfikrseveevdfagwlcktlrl