PDB entry 1s6u

View 1s6u on RCSB PDB site
Description: Solution structure and backbone dynamics of the Cu(I) form of the second metal-binding domain of the Menkes protein ATP7A
Class: hydrolase
Keywords: copper homeostasis, metal transport, Menkes, Structural Proteomics in Europe, SPINE, Structural Genomics, HYDROLASE
Deposited on 2004-01-27, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-transporting ATPase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATP7A, MNK, MC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04656 (0-71)
      • cloning artifact (72-75)
    Domains in SCOPe 2.08: d1s6ua1, d1s6ua2
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6uA (A:)
    gevvlkmkvegmtchsctstiegkigklqgvqrikvsldnqeativyqphlisveemkkq
    ieamgfpafvkkiegr