PDB entry 1s6t

View 1s6t on RCSB PDB site
Description: Crystal structure of heparan sulfate 3-O-sulfotransferase isoform 1 in the presence of PAP
Deposited on 2004-01-27, released 2004-04-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.243
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1s6ta_
  • Chain 'B':
    Domains in SCOP 1.67: d1s6tb_
  • Chain 'C':
    Domains in SCOP 1.67: d1s6tc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s6tA (A:)
    mgsshhhhhhssglvprgshmgtasngstqqlpqtiiigvrkggtrallemlslhpdvaa
    aenevhffdweehysqglgwyltqmpfssphqltvektpayftspkvperihsmnptirl
    llilrdpservlsdytqvlynhlqkhkpyppiedllmrdgrlnldykalnrslyhahmln
    wlrffplghihivdgdrlirdpfpeiqkverflklspqinasnfyfnktkgfyclrdsgk
    drclheskgrahpqvdpklldklheyfhepnkkffklvgrtfdwh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s6tA (A:)
    stqqlpqtiiigvrkggtrallemlslhpdvaaaenevhffdweehysqglgwyltqmpf
    ssphqltvektpayftspkvperihsmnptirlllilrdpservlsdytqvlynhlqkhk
    pyppiedllmrdgrlnldykalnrslyhahmlnwlrffplghihivdgdrlirdpfpeiq
    kverflklspqinasnfyfnktkgfyclrdsgkdrclheskgrahpqvdpklldklheyf
    hepnkkffklvgrtfdwh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s6tB (B:)
    mgsshhhhhhssglvprgshmgtasngstqqlpqtiiigvrkggtrallemlslhpdvaa
    aenevhffdweehysqglgwyltqmpfssphqltvektpayftspkvperihsmnptirl
    llilrdpservlsdytqvlynhlqkhkpyppiedllmrdgrlnldykalnrslyhahmln
    wlrffplghihivdgdrlirdpfpeiqkverflklspqinasnfyfnktkgfyclrdsgk
    drclheskgrahpqvdpklldklheyfhepnkkffklvgrtfdwh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s6tB (B:)
    stqqlpqtiiigvrkggtrallemlslhpdvaaaenevhffdweehysqglgwyltqmpf
    ssphqltvektpayftspkvperihsmnptirlllilrdpservlsdytqvlynhlqkhk
    pyppiedllmrdgrlnldykalnrslyhahmlnwlrffplghihivdgdrlirdpfpeiq
    kverflklspqinasnfyfnktkgfyclrdsgkdrclheskgrahpqvdpklldklheyf
    hepnkkffklvgrtfdwh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s6tC (C:)
    mgsshhhhhhssglvprgshmgtasngstqqlpqtiiigvrkggtrallemlslhpdvaa
    aenevhffdweehysqglgwyltqmpfssphqltvektpayftspkvperihsmnptirl
    llilrdpservlsdytqvlynhlqkhkpyppiedllmrdgrlnldykalnrslyhahmln
    wlrffplghihivdgdrlirdpfpeiqkverflklspqinasnfyfnktkgfyclrdsgk
    drclheskgrahpqvdpklldklheyfhepnkkffklvgrtfdwh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s6tC (C:)
    stqqlpqtiiigvrkggtrallemlslhpdvaaaenevhffdweehysqglgwyltqmpf
    ssphqltvektpayftspkvperihsmnptirlllilrdpservlsdytqvlynhlqkhk
    pyppiedllmrdgrlnldykalnrslyhahmlnwlrffplghihivdgdrlirdpfpeiq
    kverflklspqinasnfyfnktkgfyclrdsgkdrcvdpklldklheyfhepnkkffklv
    grtfdwh