PDB entry 1s6s

View 1s6s on RCSB PDB site
Description: Crystal Structure Analysis of HIV-1 Protease Mutant I84V with a Potent Non-peptide Inhibitor (UIC-94017)
Class: hydrolase
Keywords: hiv-1 protease, mutant, i84v, dimer, inhibitor, uic-94017, tmc114
Deposited on 2004-01-27, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.13
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (83)
      • engineered (94)
    Domains in SCOPe 2.07: d1s6sa_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (83)
      • engineered (94)
    Domains in SCOPe 2.07: d1s6sb_
  • Heterogens: CL, NA, 017, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6sA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6sB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf