PDB entry 1s6r

View 1s6r on RCSB PDB site
Description: 908R class c beta-lactamase bound to iodo-acetamido-phenyl boronic acid
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-01-27, released 2004-02-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1s6ra_
  • Heterogens: IAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6rA (A:)
    vsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfel
    gsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqvp
    devtdnaslvrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkpl
    kldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmapen
    vadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvvevn
    ppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhilealq