PDB entry 1s6g

View 1s6g on RCSB PDB site
Description: Crystal Structure Analysis of HIV-1 Protease with a Potent Non-peptide Inhibitor (UIC-94017)
Class: hydrolase
Keywords: hiv-1 protease; dimer; inhibitor; uic-94017; tmc114
Deposited on 2004-01-23, released 2004-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.134
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus type 1
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
• Chain 'B':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus type 1
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.06: d1s6gb_
• Heterogens: NA, CL, 017, ACY, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1s6gB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf