PDB entry 1s6c

View 1s6c on RCSB PDB site
Description: Crystal structure of the complex between KChIP1 and Kv4.2 N1-30
Class: transport protein
Keywords: EF-hand, TRANSPORT PROTEIN
Deposited on 2004-01-23, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kv4 potassium channel-interacting protein KChIP1b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: KChIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R426 (Start-182)
      • modified residue (30)
      • modified residue (165)
    Domains in SCOPe 2.07: d1s6ca_
  • Chain 'B':
    Compound: Potassium voltage-gated channel subfamily D member 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Kcnd2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s6cA (A:)
    hrpegleqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahy
    lfnafdttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivka
    iydmmgkytypvlkedtprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfq
    nvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s6cA (A:)
    leqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfnaf
    dttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydmm
    gprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvm
    

  • Chain 'B':
    No sequence available.