PDB entry 1s5i

View 1s5i on RCSB PDB site
Description: fab (lnkb-2) of monoclonal antibody to human interleukin-2, crystal structure
Deposited on 2004-01-21, released 2004-05-25
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2
AEROSPACI score: -1.72 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5iH (H:)
    gvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgstgy
    npslksrisitrdtsknqfflqlnsvttedtatyycasyddytwftywgqgtlvtvsaak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5iL (L:)
    dvqmtqtpltlsvtigqpasiscessqsllysngktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlrisrveaedlgvyycvqgthfprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec