PDB entry 1s3p

View 1s3p on RCSB PDB site
Description: Crystal structure of rat alpha-parvalbumin S55D/E59D mutant
Class: calcium-binding protein
Keywords: parvalbumin, ef-hand, calcium-binding protein
Deposited on 2004-01-13, released 2004-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parvalbumin alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PVALB, PVA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02625 (0-108)
      • engineered (54)
      • engineered (58)
    Domains in SCOPe 2.08: d1s3pa_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s3pA (A:)
    smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdkdgfide
    delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes