PDB entry 1s3e

View 1s3e on RCSB PDB site
Description: Crystal structure of MAOB in complex with 6-hydroxy-N-propargyl-1(R)-aminoindan
Class: oxidoreductase
Keywords: human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, flavin, OXIDOREDUCTASE
Deposited on 2004-01-13, released 2004-03-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.198
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Gene: MAOB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1s3ea1, d1s3ea2
  • Chain 'B':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Gene: MAOB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1s3eb1, d1s3eb2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s3eA (A:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3eA (A:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrligltti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s3eB (B:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3eB (B:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrli