PDB entry 1s3b

View 1s3b on RCSB PDB site
Description: Crystal structure of MAOB in complex with N-methyl-N-propargyl-1(R)-aminoindan
Class: oxidoreductase
Keywords: human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, flavin
Deposited on 2004-01-13, released 2004-03-30
The last revision prior to the SCOP 1.75 freeze date was dated 2004-03-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.204
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine oxidase [flavin-containing] b
    Species: HOMO SAPIENS
    Gene: MAOB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1s3ba1, d1s3ba2
  • Chain 'B':
    Compound: amine oxidase [flavin-containing] b
    Species: HOMO SAPIENS
    Gene: MAOB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1s3bb1, d1s3bb2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s3bA (A:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3bA (A:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrligltti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s3bB (B:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3bB (B:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrli