PDB entry 1s0u

View 1s0u on RCSB PDB site
Description: eIF2gamma apo
Class: translation
Keywords: translation initiation, GTPase, EF-1A, tRNA, eIF2
Deposited on 2004-01-04, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 gamma subunit
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: EIF2G, MJ1261
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58657 (5-407)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1s0ua1, d1s0ua2, d1s0ua3, d1s0ua4
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s0uA (A:)
    gplgsqaevnigmvghvdhgktsltkaltgvwtdrhseelrrgisirlgyadceirkcpq
    cgtyttkprcpnclaeteflrrvsfvdspghetlmatmlsgaslmdgailviaanepcpq
    pqtkehlmaleilgidkiiivqnkidlvdekqaeenyeqikefvkgtiaenapiipisah
    heanidvllkaiqdfiptpkrdpdatprmyvarsfdinkpgteikdlkggvlggaiiqgv
    fkvgdeieirpgikvtegnktfwkplttkivslaagntilrkahpggligvgttldpylt
    ksdaltgsvvglpgtlppirekitiranlldrvvgtkeelkieplrtgevlmlnigtatt
    agvitsargdiadiklklpicaeigdrvaisrrvgsrwrligygtieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0uA (A:)
    sqaevnigmvghvdhgktsltkaltgvwtdrgisirlgyadceirkcpqcgtyttkprcp
    nclaeteflrrvsfvdspghetlmatmlsgaslmdgailviaanepcpqpqtkehlmale
    ilgidkiiivqnkidlvdekqaeenyeqikefvkgtiaenapiipinidvllkaiqdfip
    tpkrdpdatprmyvarsfdinkpgteikdlkggvlggaiiqgvfkvgdeieirpgikvte
    gnktfwkplttkivslaagntilrkahpggligvgttldpyltksdaltgsvvglpgtlp
    pirekitiranlldrvvgtkeelkieplrtgevlmlnigtattagvitsargdiadiklk
    lpicaeigdrvaisrrvgsrwrligygtieg