PDB entry 1s0i

View 1s0i on RCSB PDB site
Description: Trypanosoma cruzi trans-sialidase in complex with sialyl-lactose (Michaelis complex)
Class: hydrolase
Keywords: transglycosidase, sialyllactose, Trypanosoma cruzi, Michaelis complex
Deposited on 2003-12-31, released 2004-05-18
The last revision prior to the SCOP 1.73 freeze date was dated 2004-05-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.165
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trans-sialidase
    Species: TRYPANOSOMA CRUZI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26966 (14-End)
      • engineered (71-72)
      • see remark 999 (275)
      • see remark 999 (489)
      • see remark 999 (497)
      • engineered (508-509)
      • engineered (533)
      • see remark 999 (571)
      • engineered (606)
      • engineered (610)
      • engineered (612)
    Domains in SCOP 1.73: d1s0ia1, d1s0ia2
  • Heterogens: SLT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s0iA (A:)
    mggshhhhhhgmaslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvm
    vaiadaryetsfanslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnkl
    yvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpae
    megmhtnqflggagvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsaf
    gcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsq
    ssftavtiegmrvmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvl
    ykddklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssictpadpaasss
    ergcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpv
    sqqgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqp
    iygstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyv
    ggykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0iA (A:)
    lapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfan
    slidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsyw
    tshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggag
    vaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkl
    iintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvm
    lfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheins
    nevyslvfarlvgelriiksvlqswknwdshlssictpagcgpavttvglvgflshsatk
    tewedayrcvnastanaervpnglkfagvgggalwpvsqqgqnqryhfanhaftlvasvt
    ihevpkgaspllgasldssggkkllglsydkrhqwqpiygstpvtptgswemgkryhvvl
    tmankigsvyidgeplegsgqtvvpdertpdishfyvggykrsgmptdsrvtvnnvllyn
    rqlnaeeirtlflsqdligteah