PDB entry 1s0h

View 1s0h on RCSB PDB site
Description: Structure determination of haemoglobin from Donkey(equus asinus) at 3.0 Angstrom resolution
Class: oxygen storage/transport
Keywords: alpha helix, dimer, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2003-12-31, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha chain
    Species: Equus asinus [TaxId:9793]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s0ha1
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Equus asinus [TaxId:9793]
    Database cross-references and differences (RAF-indexed):
    • PDB 1S0H (0-145)
    Domains in SCOPe 2.08: d1s0hb1
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s0hA (A:)
vlsaadktnvkaawskvggnagefgaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s0hB (B:)
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh