PDB entry 1s0f

View 1s0f on RCSB PDB site
Description: Crystal structure of botulinum neurotoxin type B at pH 7.0
Class: Toxin, hydrolase
Keywords: botulinum, neurotoxin, pH, metals, Toxin, hydrolase
Deposited on 2003-12-30, released 2004-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: botulinum neurotoxin type b
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s0fa1, d1s0fa2, d1s0fa3, d1s0fa4
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s0fA (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
    iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqyl
    ysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndf
    vieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellip
    vvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmyk
    alnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvs
    ylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdls
    iytndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkl
    tssanskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsg
    wkisirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingk
    lesntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsys
    eylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyi
    gekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisds
    defyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcisk
    wylkevkrkpynlklgcnwqfipkdegwte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0fA (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeiskehlavykiqmcksvgicidvdnedlffiadknsfsddlsknerieyntqsnyien
    dfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqylysq
    tfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndfvie
    anksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellipvvg
    afllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmykaln
    yqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvsylm
    kkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdlsiyt
    ndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkltss
    anskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsgwki
    sirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingkles
    ntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyseyl
    kdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyigek
    fiirrksdivrkedyiyldffnlnqewrvytykyfkkeeeklflapisdsdefyntiqik
    eydeqptyscqllfkkdeestdeigligihrfyesgeykdyfciskwylkevkrkpynlk
    lgcnwqfipkdegwte