PDB entry 1rzt

View 1rzt on RCSB PDB site
Description: Crystal structure of DNA polymerase lambda complexed with a two nucleotide gap DNA molecule
Class: transferase/DNA
Keywords: DNA polymerase lambda, TRANSFERASE/DNA COMPLEX
Deposited on 2003-12-29, released 2004-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.227
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rzta1, d1rzta2, d1rzta3
  • Chain 'B':
    Compound: 5'-d(*cp*gp*gp*cp*ap*ap*cp*gp*cp*ap*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*tp*gp*cp*g)-3'
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'E':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rzte1, d1rzte2, d1rzte3
  • Chain 'F':
    Compound: 5'-d(*cp*gp*gp*cp*ap*ap*cp*gp*cp*ap*c)-3'
  • Chain 'G':
    Compound: 5'-d(*gp*tp*gp*cp*g)-3'
  • Chain 'H':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'I':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rzti1, d1rzti2, d1rzti3
  • Chain 'J':
    Compound: 5'-d(*cp*gp*gp*cp*ap*ap*cp*gp*cp*ap*c)-3'
  • Chain 'K':
    Compound: 5'-d(*gp*tp*gp*cp*g)-3'
  • Chain 'L':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'M':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rztm1, d1rztm2, d1rztm3
  • Chain 'N':
    Compound: 5'-d(*cp*gp*gp*cp*ap*ap*cp*gp*cp*ap*c)-3'
  • Chain 'O':
    Compound: 5'-d(*gp*tp*gp*cp*g)-3'
  • Chain 'P':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Heterogens: NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rztA (A:)
    ssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipg
    igkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledir
    sqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkat
    cgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgr
    rhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgck
    vgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rztA (A:)
    atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
    maekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqas
    lttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdv
    dvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrr
    ldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpg
    rvlptptekdvfrllglpyrepaerdw
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rztE (E:)
    ssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipg
    igkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledir
    sqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkat
    cgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgr
    rhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgck
    vgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rztE (E:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrl
    diivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgr
    vlptptekdvfrllglpyrepaerdw
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1rztI (I:)
    ssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipg
    igkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledir
    sqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkat
    cgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgr
    rhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgck
    vgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rztI (I:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrl
    diivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgr
    vlptptekdvfrllglpyrepaerdw
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1rztM (M:)
    ssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipg
    igkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledir
    sqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkat
    cgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgr
    rhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgck
    vgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rztM (M:)
    atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
    maekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqas
    lttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdv
    dvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrr
    ldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpg
    rvlptptekdvfrllglpyrepaerdw
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.