PDB entry 1rzh

View 1rzh on RCSB PDB site
Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg m233 replaced with cys in the charge-neutral dqaqb state (trigonal form)
Class: photosynthesis
Keywords: bacterial photosynthesis, rhodobacter sphaeroides, proton transfer pathway, revertant, integral membrane protein, photosynthesis
Deposited on 2003-12-24, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.221
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: puhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rzhh1, d1rzhh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02954 (0-280)
      • engineered (212)
    Domains in SCOPe 2.07: d1rzhl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02953 (0-End)
      • engineered (232)
    Domains in SCOPe 2.07: d1rzhm_
  • Heterogens: BCL, BPH, U10, HTO, FE2, PO4, SPO, LDA, CDL, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rzhH (H:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzhH (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzhL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhentffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1rzhM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggeceleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzhM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggeceleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    h