PDB entry 1rzf

View 1rzf on RCSB PDB site
Description: Crystal structure of Human anti-HIV-1 GP120-reactive antibody E51
Deposited on 2003-12-24, released 2004-02-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-16, with a file datestamp of 2004-03-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rzfH (H:)
    evqlvqsgaevnkpgssvkvscqasgatlnshafswvrqapgqglewmagiipifgsshy
    aqkfrgrvtisadestrtvylhlrglrsddtavyycasnsiagvaaagdyadydggyyyd
    mdvwgqgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgal
    tsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzfH (H:)
    vqlvqsgaevnkpgssvkvscqasgatlnshafswvrqapgqglewmagiipifgsshya
    qkfrgrvtisadestrtvylhlrglrsddtavyycasnsiaggyyydmdvwgqgttvtvs
    sastkgpsvfplaptsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzfL (L:)
    qsiltqppsvsaapgqkvtiscsgsssnignndvswyqqfpgtvpklviyennerpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsavvfgggskvtvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt