PDB entry 1ryt

View 1ryt on RCSB PDB site
Description: rubrerythrin
Class: electron transport
Keywords: electron transport, iron, ferroxidase
Deposited on 1996-04-26, released 1997-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubrerythrin
    Species: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ryta1, d1ryta2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rytA (A:)
    kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
    kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
    asiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahpk
    ahfellginw