PDB entry 1ryp

View 1ryp on RCSB PDB site
Description: crystal structure of the 20s proteasome from yeast at 2.4 angstroms resolution
Deposited on 1997-02-26, released 1998-04-15
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-15, with a file datestamp of 1998-04-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.286
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.55: d1ryp1_
  • Chain '2':
    Domains in SCOP 1.55: d1ryp2_
  • Chain 'A':
    Domains in SCOP 1.55: d1rypa_
  • Chain 'B':
    Domains in SCOP 1.55: d1rypb_
  • Chain 'C':
    Domains in SCOP 1.55: d1rypc_
  • Chain 'D':
    Domains in SCOP 1.55: d1rypd_
  • Chain 'E':
    Domains in SCOP 1.55: d1rype_
  • Chain 'F':
    Domains in SCOP 1.55: d1rypf_
  • Chain 'G':
    Domains in SCOP 1.55: d1rypg_
  • Chain 'H':
    Domains in SCOP 1.55: d1ryph_
  • Chain 'I':
    Domains in SCOP 1.55: d1rypi_
  • Chain 'J':
    Domains in SCOP 1.55: d1rypj_
  • Chain 'K':
    Domains in SCOP 1.55: d1rypk_
  • Chain 'L':
    Domains in SCOP 1.55: d1rypl_
  • Chain 'M':
    Domains in SCOP 1.55: d1rypm_
  • Chain 'N':
    Domains in SCOP 1.55: d1rypn_
  • Chain 'O':
    Domains in SCOP 1.55: d1rypo_
  • Chain 'P':
    Domains in SCOP 1.55: d1rypp_
  • Chain 'Q':
    Domains in SCOP 1.55: d1rypq_
  • Chain 'R':
    Domains in SCOP 1.55: d1rypr_
  • Chain 'S':
    Domains in SCOP 1.55: d1ryps_
  • Chain 'T':
    Domains in SCOP 1.55: d1rypt_
  • Chain 'U':
    Domains in SCOP 1.55: d1rypu_
  • Chain 'V':
    Domains in SCOP 1.55: d1rypv_
  • Chain 'W':
    Domains in SCOP 1.55: d1rypw_
  • Chain 'X':
    Domains in SCOP 1.55: d1rypx_
  • Chain 'Y':
    Domains in SCOP 1.55: d1rypy_
  • Chain 'Z':
    Domains in SCOP 1.55: d1rypz_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ryp1 (1:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ryp2 (2:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypA (A:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypB (B:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypC (C:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypD (D:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypE (E:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
    geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
    ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
    ae
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypF (F:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypG (G:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypH (H:)
    lkkgevslgasimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaad
    tqaiadivqyhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevy
    tiplggsvhklpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssgg
    virmvvltaagverlifypdeyeql
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypI (I:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypJ (J:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypK (K:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypL (L:)
    tttlafrfqggiivavdsratagnwvasqtvkrvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypM (M:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypN (N:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypO (O:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypP (P:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypQ (Q:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypR (R:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypS (S:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
    geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
    ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
    ae
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypT (T:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypU (U:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypV (V:)
    lkkgevslgasimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaad
    tqaiadivqyhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevy
    tiplggsvhklpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssgg
    virmvvltaagverlifypdeyeql
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypW (W:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypX (X:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypY (Y:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rypZ (Z:)
    tttlafrfqggiivavdsratagnwvasqtvkrvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig