PDB entry 1rxo

View 1rxo on RCSB PDB site
Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium
Class: lyase (carbon-carbon)
Keywords: lyase (carbon-carbon)
Deposited on 1996-12-06, released 1997-06-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875
      • modified residue (200)
    Domains in SCOPe 2.05: d1rxob1, d1rxob2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.05: d1rxoc_
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875
      • modified residue (200)
    Domains in SCOPe 2.05: d1rxoe1, d1rxoe2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.05: d1rxof_
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875
      • modified residue (200)
    Domains in SCOPe 2.05: d1rxoh1, d1rxoh2
  • Chain 'I':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.05: d1rxoi_
  • Chain 'L':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00875
      • modified residue (200)
    Domains in SCOPe 2.05: d1rxol1, d1rxol2
  • Chain 'S':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.05: d1rxos_
  • Heterogens: RUB, CA, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rxoB (B:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxoB (B:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoC (C:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rxoE (E:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxoE (E:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoF (F:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rxoH (H:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxoH (H:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoI (I:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rxoL (L:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxoL (L:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoS (S:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy