PDB entry 1rxo

View 1rxo on RCSB PDB site
Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium
Deposited on 1996-12-06, released 1997-06-16
The last revision prior to the SCOP 1.55 freeze date was dated 1997-06-16, with a file datestamp of 1997-06-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoB (B:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoC (C:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoE (E:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoF (F:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoH (H:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoI (I:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoL (L:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxoS (S:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy