PDB entry 1rwd

View 1rwd on RCSB PDB site
Description: Backbone NMR Structure of a Mutant P. Furiosus Rubredoxin Using Residual Dipolar Couplings
Class: electron transport
Keywords: NMR, residual dipolar couplings, structural genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, ELECTRON TRANSPORT
Deposited on 2003-12-16, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: RUB, PF1282
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297 (0-End)
      • engineered (2)
      • engineered (22)
      • engineered (31)
    Domains in SCOPe 2.07: d1rwda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rwdA (A:)
    akyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefekled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rwdA (A:)
    akyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefek