PDB entry 1rw8

View 1rw8 on RCSB PDB site
Description: Crystal Structure of TGF-beta receptor I kinase with ATP site inhibitor
Class: transferase
Keywords: TGF-beta receptor I, Protein Kinase, TRANSFERASE
Deposited on 2003-12-16, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.26
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tgf-beta receptor type I
    Species: Homo sapiens [TaxId:9606]
    Gene: Tru
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rw8a_
  • Heterogens: 580, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rw8A (A:)
    tiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
    lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
    ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkrym
    apevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsve
    emrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqe
    g