PDB entry 1rw1

View 1rw1 on RCSB PDB site
Description: yffb (pa3664) protein
Class: structural genomics, unknown function
Keywords: thioredoxin fold, Structure 2 Function Project, S2F, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2003-12-15, released 2004-11-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: 0.129
AEROSPACI score: 1.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein yffB
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: yffB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXX5 (0-113)
      • modified residue (12)
      • modified residue (81)
      • modified residue (87)
    Domains in SCOPe 2.01: d1rw1a_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rw1A (A:)
    tyvlygikacdtmkkartwldehkvaydfhdykavgidrehlrrwcaehgwqtvlnragt
    tfrkldeaqkadldeakaielmlaqpsmikrpvlelggrtlvgfkpdayaaala