PDB entry 1rv7
View 1rv7 on RCSB PDB site
Description: Crystal structures of a Multidrug-Resistant HIV-1 Protease Reveal an Expanded Active Site Cavity
Class: hydrolase
Keywords: HIV protease, AIDS, polyprotein, hydrolase, aspartyl protease, multi-drug resistance, Lopinavir
Deposited on
2003-12-12, released
2004-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.271
AEROSPACI score: 0.18
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: HIV-1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9QM22 (0-98)
- engineered (24)
- engineered (35)
- engineered (83)
Domains in SCOPe 2.06: d1rv7a_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: HIV-1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9QM22 (0-98)
- engineered (24)
- engineered (35)
- engineered (83)
Domains in SCOPe 2.06: d1rv7b_ - Heterogens: AB1, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1rv7A (A:)
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1rv7B (B:)
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf