PDB entry 1rus

View 1rus on RCSB PDB site
Description: crystal structure of the binary complex of ribulose-1,5-bisphosphate carboxylase and its product, 3-phospho-d-glycerate
Class: lyase(carbon-carbon)
Keywords: lyase(carbon-carbon)
Deposited on 1991-10-10, released 1991-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04718
      • conflict (114)
    Domains in SCOPe 2.07: d1rusa1, d1rusa2
  • Chain 'B':
    Compound: rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04718
      • conflict (114)
    Domains in SCOPe 2.07: d1rusb1, d1rusb2
  • Heterogens: 3PG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rusA (A:)
    tmitnspdrwgysaphrtsresppmdqssryvnlalkeedliaggehvlcayimkpkagy
    gyvataahfaaesstgtnvevcttddftrgvdalvyevdeareltkiaypvalfdrnitd
    gkamiasfltltmgnnqgmgdveyakmhdfyvpeayralfdgpsvnisalwkvlgrpevd
    gglvvgtiikpklglrpkpfaeachafwlggdfikndepqgnqpfaplrdtialvadamr
    raqdetgeaklfsanitaddpfeiiargeyvletfgenashvallvdgyvagaaaittar
    rrfpdnflhyhraghgavtspqskrgytafvhckmarlqgasgihtgtmgfgkmegessd
    raiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffenlgnanviltaggga
    fghidgpvagarslrqawqawrdgvpvldyarehkelarafesfpgdadqiypgwrkalg
    vedtrsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rusA (A:)
    qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgttrgvdalvy
    evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
    ralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikn
    depqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfg
    enashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckma
    rlqgasgihtgtmssdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgff
    enlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesf
    pgdadqiypgwrkalgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rusB (B:)
    tmitnspdrwgysaphrtsresppmdqssryvnlalkeedliaggehvlcayimkpkagy
    gyvataahfaaesstgtnvevcttddftrgvdalvyevdeareltkiaypvalfdrnitd
    gkamiasfltltmgnnqgmgdveyakmhdfyvpeayralfdgpsvnisalwkvlgrpevd
    gglvvgtiikpklglrpkpfaeachafwlggdfikndepqgnqpfaplrdtialvadamr
    raqdetgeaklfsanitaddpfeiiargeyvletfgenashvallvdgyvagaaaittar
    rrfpdnflhyhraghgavtspqskrgytafvhckmarlqgasgihtgtmgfgkmegessd
    raiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffenlgnanviltaggga
    fghidgpvagarslrqawqawrdgvpvldyarehkelarafesfpgdadqiypgwrkalg
    vedtrsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rusB (B:)
    qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtgvdalvyev
    deareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeayra
    lfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfiknde
    pqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfgen
    ashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckmarl
    qgasgihtgtmssdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffen
    lgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesfpg
    dadqiypgwrkalgv