PDB entry 1ruq

View 1ruq on RCSB PDB site
Description: Crystal Structure (H) of u.v.-irradiated Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set collected in house.
Deposited on 2003-12-11, released 2004-03-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.219
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruqH (H:)
    evqleesgpelvrpgtsvkisckasgytftnywlgwvkqrpghgfewigdiypggvyttn
    nekfrgkailtadtssstaymqlssltsedsavyfcaraggyytggdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruqL (L:)
    divltqaafsnpvtlgasasiscrssksllnsngiihmywylqkpgqspqlliyqmskla
    sgapdrfsgsgsgtdftlrisrveaedvgvyycaqnlelpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdtkdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn