PDB entry 1rua

View 1rua on RCSB PDB site
Description: crystal structure (b) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected at ssrl beamline 11-1.
Deposited on 2003-12-11, released 2004-03-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.194
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruaH (H:)
    rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
    npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruaL (L:)
    dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec