PDB entry 1rtx

View 1rtx on RCSB PDB site
Description: Crystal Structure of Synechocystis Hemoglobin with a Covalent Heme Linkage
Class: oxygen storage/transport
Keywords: Synechocystis hemoglobin, hexacoordinate, hemichrome, truncated, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2003-12-10, released 2004-04-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanoglobin
    Species: Synechocystis sp. [TaxId:1148]
    Gene: GLBN, SLR2097
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1rtxa_
  • Heterogens: CD, SO4, K, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtxA (A:)
    stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
    dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
    lnq