PDB entry 1rsv

View 1rsv on RCSB PDB site
Description: azide complex of the diferrous E238A mutant R2 subunit of ribonucleotide reductase
Class: Oxidoreductase
Keywords: Diiron, Azide, radical generation, chemical rescue, Oxidoreductase
Deposited on 2003-12-10, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase 1 beta chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-End)
      • engineered (121)
      • engineered (237)
    Domains in SCOPe 2.07: d1rsva_
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase 1 beta chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-End)
      • engineered (121)
      • engineered (237)
    Domains in SCOPe 2.07: d1rsvb_
  • Heterogens: FE, HG, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rsvA (A:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardaal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvsdnvqvapqevevssylvgq
    idsevdtddlsnfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rsvA (A:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardaal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rsvB (B:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardaal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvsdnvqvapqevevssylvgq
    idsevdtddlsnfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rsvB (B:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardaal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs