PDB entry 1rsc

View 1rsc on RCSB PDB site
Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate
Deposited on 1994-03-29, released 1995-05-08
The last revision prior to the SCOP 1.59 freeze date was dated 1995-05-08, with a file datestamp of 1995-05-09.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.255
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rscA (A:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rscM (M:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr