PDB entry 1rro

View 1rro on RCSB PDB site
Description: refinement of recombinant oncomodulin at 1.30 angstroms resolution
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1992-08-27, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.176
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rat oncomodulin
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02631 (0-107)
  Domains in SCOP 1.75: d1rroa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rroA (A:)
  sitdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldg
  delkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs