PDB entry 1rro

View 1rro on RCSB PDB site
Description: refinement of recombinant oncomodulin at 1.30 angstroms resolution
Deposited on 1992-08-27, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.3 Å
R-factor: 0.176
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1rro__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rro_ (-)
    sitdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldg
    delkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs