PDB entry 1rro

View 1rro on RCSB PDB site
Description: refinement of recombinant oncomodulin at 1.30 angstroms resolution
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1992-08-27, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rat oncomodulin
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rroa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rroA (A:)
    sitdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldg
    delkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs