PDB entry 1rqx

View 1rqx on RCSB PDB site
Description: Crystal structure of ACC Deaminase complexed with Inhibitor
Class: hydrolase
Keywords: ACCD, Complex, crystal, PLP, Inhibitor, HYDROLASE
Deposited on 2003-12-07, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rqxa_
  • Chain 'B':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rqxb_
  • Chain 'C':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rqxc_
  • Chain 'D':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rqxd_
  • Heterogens: PLP, MLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rqxA (A:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqxA (A:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelg
    fkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvg
    lerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvr
    ngefpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rqxB (B:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqxB (B:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelgfkf
    dyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvgler
    dimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvrnge
    fpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rqxC (C:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rqxD (D:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqxD (D:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelgfk
    fdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvgle
    rdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvrng
    efpegsrvlyahlggvpalngysfifrdg